T Coffee Server (Multiple Sequence Alignment @ EMBL EBI)

ClustalW2 Server (Multiple Sequence Alignment @ EMBL EBI)

Pfam Database Server (Protein Families @ Wellcome Trust Sanger Institute)


>ALDH1A3_v4_NP_695212(Source : NCBI - Entrez Protein, Rattus norvegicus)
MATANGAVENGQPDGKPPALPRPIRNLEVKFTKIFINNDWHEPKSGRKFATYNPSTLEKICEVEEGDKPD
VDKAVEAAQAAFQRGSPWRRLDALSRGQLLHQLADLIERDRAILATLETMDTGKPFLHAFFVDLEGCIKT
FRYFAGWADKIQGRTIPTDDNVMCFTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPAEQTP
LTALYLASLIKEVGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLE
LGGRNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFAKKRPVGDPFDAK
TEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVFSDVTDNMRIAKEEIFGPVQPIL
KFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWVNCYNAFYAQAPFGGFKMSGNGRELG
EYALAEYTEVKTVTIKLDEKNP