T Coffee Server (Multiple Sequence Alignment @ EMBL EBI)

ClustalW2 Server (Multiple Sequence Alignment @ EMBL EBI)

Pfam Database Server (Protein Families @ Wellcome Trust Sanger Institute)


>ALDH1A7_Variant_TBD_NP_058968(Source : NCBI - GenBank, Rattus norvegicus)
MSSPAQPAVPAPLANLKIQHTKIFINNEWHNSLNGKKFPVINPATEEVICHVEEGDKADVDKAVKAARQA
FQIGSPWRTMDASERGCLLNKLADLMERDRVLLATMESMNAGKIFTHAYLLDTEVSIKALKYFAGWADKI
HGQTIPSDGDVFTYTRREPIGVCGQIIPWNGPLILFIWKIGAALSCGNTVIVKPAEQTPLTALYMASLIK
EAGFPPGVVNVVPGYGSTAGAAISSHMDIDKVSFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVFA
DADLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERAKKYVLGNPLDSGISQGPQIDKEQ
HAKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSIDEVIKR
ANNTPYGLAAGVFTKDLDRAITVSSALQAGTVWVNCYLTLSVQCPFGGFKMSGNGREMGEQGVYEYTELK
TVAMKISQKNS

>ALDH1A7_Variant_TBD_ENSRNOP00000024093(Source : EBI, WTSI - Ensembl - TransView, Rattus norvegicus)
IFINNEWHDSVSHEKFPVINPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKL
ADLMERDHLLLATMESMNAGKFTHAYMLDTEVSIKALKYFAGWADKIHGQTIPSGEYMCYTRREHIGVCG
QIIPWNGPLVSFIWKIGPALSCGNTVIVKPAEQTPLTALHMASLIKEAGFPPGVVNVVPGYGPTAGAAIS
SHMDIDKVSFTGSTEVGPFFEKLLNDLFLIPDSKYAYEMQVDKFWIKVNVSFAVDSAVEFAHQGVFFHQG
QICVAASRLFVEESIYDEFVRRSVERAKKYVLGNPLDSGMSQGPQIDKEQHVKILDLIESGKKEGAKLEC
GGGRWGNKGFFVQPTVFSNVTDEMRIAKEEVMFP

>ALDH1A7_Variant_TBD_ENSRNOP00000051666(Source : EBI, WTSI - Ensembl - TransView, Rattus norvegicus)
KSPAQFSVPTRKRAKPAMSSPAQPEVPAPLDNLKIQHTKIFINNEWHDSVSHEKFPVINPATEEVICHVE
EGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDHLLLATMESMNAGKFTHAYMLDTE
VSIKALKYFAGWADKIHGQTIPSVKTYFCYTRREHIGVCGQIIPWNGPLVSFI

>ALDH1A7_Variant_TBD_ENSRNOP00000051667(Source : EBI, WTSI - Ensembl - TransView, Rattus norvegicus)
MSSPAQPEVPAPLDNLKIQHTKIFINNEWHDSVSHEKFPVINPATEEVICHVEEGDKADVDKAVKAARQA
FQIGSPWRTMDASERGRLLNKLADLMERDHLLLATMESMNAGKFTHAYMLDTEVSIKALKYFAGWADKIH
GQTIPSESNMEMFFTYTRREHIGVCGQIIPWNGPLVSFIWKIGPALSCGNTVIVKPAEQTPLTALHMASL
IKEAGFPPGVVNVVPGYGPTAG

>ALDH1A7_Variant_TBD_ENSRNOP00000051668(Source : EBI, WTSI - Ensembl - TransView, Rattus norvegicus)
IFINNEWHDSVSHEKFPVINPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKL
ADLMERDHLLLATMESMNAGKFTHAYMLDTEVSIKALKYFAGWADKIHGQTIPSVKTYFCYTRREHIGVC
GQIIPWNGPLVSFIWKIGPALSCGNTVIVKPAEQTPLTALHMASLIKEAGFPPGVVNVVPGYGPTAGAAI
SSHMDIDKVSFTGSTEVGPFFVKTAGQSTLKVTRLMTCQYPEVLLSIPDLDSAVEFAHQGVFFHQGQICV
AASRLFVEESIYDEFVRRSVERAKKYVLGNPLDSGMSQGPQVSKHWKDSISEDLHLKSKESEFLCLKFKR
YIFKLLYFGQYKTALLLLEIQIFGPVQQIMKFKSIDEVIKRANNTPYGLAAGVFTKDLDRAITVSSALQA
GTVW

>ALDH1A7_Variant_TBD_ENSRNOP00000051669(Source : EBI, WTSI - Ensembl - TransView, Rattus norvegicus)
LCTQIFINNEWHDSVSHEKFPVINPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRL
LNKLADLMERDHLLLADYPLLKTCKIFIVEAYMLDTEVSIKALKYFAGWADKIHGQTIPSVKTYFCYTRR
EHIGVCGQIIPWNGPLVSFIWKIGPALSCGNTVIVKPAEQTPLTALHMASLIKEAGFPPGVVNVVPGYGP
TAGAAISSHMDIDKVSFTGSTEPYIQHLLIAHRFTPNFYKHELNILHISFVVIISTVNKVDSAVEFAHQG
VFFHQGQICVAASRLFVEESIYDEFVRRSVERAKKYVLGNPLDSGMSQGPQVSKHWKDSISEHLKSKESE
FLCLKFKRYIFKLLYFGQYKTALLLLEIQIFGPVQQIMKFKSIDEVIKRANNTPYGLAAGVFTKDLDRAI
TVSSALQAGTVW

>ALDH1A7_Variant_TBD_ENSRNOP00000051670(Source : EBI, WTSI - Ensembl - TransView, Rattus norvegicus)
MSSPAQPEVPAPLDNLKIQHTKIFINNEWHDSVSHEKFPVINPATEEVICHVEEGDKADVDKAVKAARQA
FQIGSPWRTMDASERGRLLNKLADLMERDHLLLATMESMNAGKFTHAYMLDTEVSIKALKYFAGWADKIH
GQTIPSVKTYFCYTRREHIGVCGQIIPWNGPLVSFIWKIGPALSCGNTVIVKPAEQTPLTALHMASLIKE
AGFPPGVVNVVPGYGPTAGAAISSHMDIDKVSFTGSTEIIGALIQFVSARGRWALSIAACLSCDCLFSLL
MDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERAKKYVLGNPLDSGMSQGPQVSKHWKDS
ISEAIETGHKNNKSLCTFGQYKTALLLLDFTIHVHISKDIVLAFEEIFGPVQQIMKFKSIDEVIKRANNT
PYGLAAGVFTKDLDRAITVSSALQAGTVW

>ALDH1A7_Variant_TBD_ENSRNOP00000051671(Source : EBI, WTSI - Ensembl - TransView, Rattus norvegicus)
LFQNQFAEPVTCVPGAKPAMSSPAQPEVPAPLDNLKIQHTKIFINNEWHDSVSHEKFPVINPATEEVICH
VEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDHLLLATMESMNAGKFTHAYMLD
TEVSIKALKYFAGWADKIHGQTIPSVKTYFCYTRREHIGVCGQIIPWNGPLVSFIWKIGPALSCGNTVIV
KPAEQTPLTALHMASLIKEAGFPPGVVNVVPGYGPTAGAAISSHMDIDKVSFTGSTEVGPFFVKTAGQST
LKVTRLMTCQYPEVLLSIPDLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERAKKYVLG
NPLDSGMSQGPQVSKHWKDSISEFIGFGQYKTALLLLLEYRYLEKNPSVSSYLEGEISTELLVSVTHIFG
PVQQIMKFKSIDEVIKRANNTPYGLAAGVFTKDLDRAITVSSALQAGTVW