T Coffee Server (Multiple Sequence Alignment @ EMBL EBI)

ClustalW2 Server (Multiple Sequence Alignment @ EMBL EBI)

Pfam Database Server (Protein Families @ Wellcome Trust Sanger Institute)


>ALDH3A1_v5_ENSP00000334590(Source : EBI, WTSI - Ensembl - ProtView, Homo sapiens)
MSPWRRRPRLSRTSSTSTRSHWAWSSSLAPGTTPSTSPSSPWWAPSLQVHGPVGREAGGAPSPSVEPSQD
GLRPVLRVLGSDKGLLGLSQEAVGTKLFSQASWCLRSSQAQVSTPGDTERACLPPPLLGGWSFCHLICIR
ASFLEWASAVLPTGPPEPLSPFCFSSNISATQRARWCSSGQRVPVCVPLSCARACSWVCPVTCACLLTTL
PSTVPRTHNGGEASGVVLGRAEPLVKYPGHRPGSVCSAGNSVVLKPSELSENMASLLATIIPQYLDKDLY
PVINGGVPETTELLKERFDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIA
WGKFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEGQKV
AYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREKPLALYMFSSNDKV
IKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVRPLMNDEGLKVRY
PPSPAKMTQH