T Coffee Server (Multiple Sequence Alignment @ EMBL EBI)

ClustalW2 Server (Multiple Sequence Alignment @ EMBL EBI)

Pfam Database Server (Protein Families @ Wellcome Trust Sanger Institute)


>ALDH3B1_v1_ENSMUSP00000056276(Source : EBI, WTSI - Ensembl - ProtView, Mus musculus)
MDSFEDKLQQLREAFKEGRTRSAEFRAAQLQGLSHFLRDNKQQLQEALAQDLHKSAFEAEVSEIAISQAE
VDLALRNLRSWMKDEKVSKNLATQLDSAFIRKEPFGLVLIIVPWNYPINLTLVPLVGAIAAGNCVVLKPS
EISKATEKILAEVLPRYLDQSCFTVVLGGRQETGQLLEHKFDYIFFTGNAYVGKIVMAAAAKHLTPITLE
LGGKNPCYVDDNCDPQIVANRVAWFRYFNAGQTCVAPDYILCSQEMQERLVPALQNAITRFYGDNPQTSP
NLGRIINQKHFKRLQGLLGCGRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDE
AIEFMNRREKPLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMHMTLSSLPFGGVGTSGMGRYHGKFSFD
TFSNQRACLLRSPGMEKINDLRYPPYSSRNLRVLLVAMEERCCSCTLL

>ALDH3B1_v1_NP_080592(Source : NCBI - Entrez Protein, Mus musculus)
MDSFEDKLQQLREAFKEGRTRSAEFRAAQLQGLSHFLRDNKQQLQEALAQDLHKSAFEAEVSEIAISQAE
VDLALRNLRSWMKDEKVSKNLATQLDSAFIRKEPFGLVLIIVPWNYPINLTLVPLVGAIAAGNCVVLKPS
EISKATEKILAEVLPRYLDQSCFTVVLGGRQETGQLLEHKFDYIFFTGNAYVGKIVMAAAAKHLTPITLE
LGGKNPCYVDDNCDPQIVANRVAWFRYFNAGQTCVAPDYILCSQEMQERLVPALQNAITRFYGDNPQTSP
NLGRIINQKHFKRLQGLLGCGRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDE
AIEFMNRREKPLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMHMTLSSLPFGGVGTSGMGRYHGKFSFD
TFSNQRACLLRSPGMEKINDLRYPPYSSRNLRVLLVAMEERCCSCTLL