T Coffee Server (Multiple Sequence Alignment @ EMBL EBI)

ClustalW2 Server (Multiple Sequence Alignment @ EMBL EBI)

Pfam Database Server (Protein Families @ Wellcome Trust Sanger Institute)


>ALDH8A1_v1_XP_001065122(Source : NCBI - GenBank, Rattus norvegicus)
MAGKRELLMLENFIGGKFLPCNSYIDSYDPSTGEVYCKVPNSGKEEIEVAVQAAREAFPAWSSRSPQERS
LILNRVADVLEQSLEELAQAESKDQGKTLTLARTMDIPRSVLNFRFFASSIQHHVSDCTEMSHLGCMHYT
VRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPSELTSVTAWMFCKLLDKAGVPPGVINVVFGT
GPRVGEALVSHPEVPVISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLEECIPATVRSSF
ANQGEICLCTSRIFVQRSIYNEFLKRFVEATRKWKVGIPSDPSANMGALISKAHFGERIRGRWGSAGYFM
LPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIARANGVKYGLGATVWSKDVGRIHRVAKRLQSGLV
WTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITIKY